Sermorelin 5mg
Sermorelin is a 29 amino acid synthetic peptide matching the first 29 residues of human growth hormone releasing hormone, with an amidated C terminus. It was developed in the 1980s and is the native sequence on which Modified GRF (1-29), sold as CJC-1295 (No DAC), is based. DryV supplies it as a lyophilized powder in a 5mg vial. Every lot is tested by our supplier and independently retested by Freedom Diagnostics using HPLC and mass spectrometry, with identity and purity posted on the COA. For laboratory research use only.
- Molecular Formula: C149H246N44O42S
- Molecular Weight: 3357.9 g/mol
- CAS Number: 86168-78-7
- Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
- Form: Lyophilized powder
Related Products
All products sold by DryV Life are supplied for laboratory research use only. They are not for human or animal consumption and are not intended to diagnose, treat, cure, or prevent any disease or condition. These products have not been evaluated by the FDA.