LL-37 5mg
LL-37 is a 37 amino acid peptide and the only known human member of the cathelicidin peptide family. Its name comes from its structure: it begins with two leucine residues (LL) and is 37 amino acids long. It is cleaved from a larger precursor protein known as hCAP18. DryV supplies it as a lyophilized powder in a 5mg vial. A Freedom Diagnostics COA for this product will be posted on our Lab Results page once testing is complete. For laboratory research use only.
- Molecular Formula: C205H340N60O53
- Molecular Weight: 4493.3 g/mol
- CAS Number: 154947-66-7
- Sequence: [LL-37, 37 aa]
- Form: Lyophilized powder
Related Products
All products sold by DryV Life are supplied for laboratory research use only. They are not for human or animal consumption and are not intended to diagnose, treat, cure, or prevent any disease or condition. These products have not been evaluated by the FDA.