IGF-1 LR3 1mg

IGF-1 LR3 is an 83 amino acid analog of human insulin-like growth factor 1. Its name describes its two modifications: a 13 amino acid extension at the N terminus (the "Long") and an arginine in place of glutamic acid at position 3 (the "R3"). The molecule is held in shape by three disulfide bonds. DryV supplies it as a lyophilized powder in a 1mg vial. Every lot is tested by our supplier and independently retested by Freedom Diagnostics using HPLC and mass spectrometry, with identity and purity posted on the COA. For laboratory research use only.

• Molecular Formula: C400H619N111O115S9
• Molecular Weight: 9111.5 g/mol
• CAS Number: 143045-27-6
• Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
• Form: Lyophilized powder

View COA

Related Products

• LL-37 5mg
• DSIP 10mg
• Kisspeptin 10mg
• DryV3-RT

All products sold by DryV Life are supplied for laboratory research use only. They are not for human or animal consumption and are not intended to diagnose, treat, cure, or prevent any disease or condition. These products have not been evaluated by the FDA.