Tesamorelin 10mg

Tesamorelin is a 44 amino acid synthetic analog of full length growth hormone releasing hormone. It is distinguished by a trans-3-hexenoyl group attached at the N terminus, a modification added to the native sequence to increase the peptide's stability. DryV supplies it as a lyophilized powder in a 10mg vial. Every lot is tested by our supplier and independently retested by Freedom Diagnostics using HPLC and mass spectrometry, with identity and purity posted on the COA. For laboratory research use only.

• Molecular Formula: C221H366N72O67S
• Molecular Weight: 5135.9 g/mol
• CAS Number: 218949-48-5
• Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
• Form: Lyophilized powder

View COA

Related Products

• Blaze 10mg/3mg
• AOD-9604 2mg
• Epitalon 10mg
• Thymosin Alpha-1 10mg

All products sold by DryV Life are supplied for laboratory research use only. They are not for human or animal consumption and are not intended to diagnose, treat, cure, or prevent any disease or condition. These products have not been evaluated by the FDA.